missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. PACRG Antibody - Azide and BSA Free, Novus Biologicals™

PACRG Antibody - Azide and BSA Free, Novus Biologicals™

Code produit 18656502 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
18656502 0.02 mL 0.02mL
18637712 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18656502 Supplier Novus Biologicals Supplier No. NBP2944450.02ml

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PACRG Polyclonal antibody specifically detects PACRG in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigène PACRG
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500-1:2000
Formule PBS (pH 7.3), 50% glycerol
Alias de gène FLJ32724, Glup, HAK005771, Molecular chaperone/chaperonin-binding protein, PARK2 co-regulated, PARK2 coregulated gene protein, PARK2CRG, parkin coregulated gene protein, parkin co-regulated gene protein, RP3-495O10.2
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1). IIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPT
Méthode de purification Affinity purified
Quantité 0.02 mL
État réglementaire RUO
Disciplines de recherche Cell Biology, Neurodegeneration, Neuroscience
Primaire ou secondaire Primary
Identification génétique (Entrez) 135138
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.