missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PATJ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP3-38552-20ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
PATJ Polyclonal antibody specifically detects PATJ in Human,Mouse samples. It is validated for ELISA,Western Blot
Spécification
| PATJ | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| channel-interacting PDZ domain protein, FLJ26982, hINADL, inactivation no after-potential D-like protein, Inadl protein, InaD-like, InaD-like (Drosophila), inaD-like protein, Pals1-associated tight junction protein, PATJCipp, PDZ domain protein, Protein associated to tight junctions | |
| A synthetic peptide corresponding to a sequence within amino acids 450-680 of human PATJ (NP_795352.2).,, Sequence:, MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN | |
| 20 μL | |
| Signal Transduction | |
| 10207 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu