PATJ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP2-55886

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18203292

624.00€ / 100µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

PATJ Polyclonal specifically detects PATJ in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spécification

Antigène	PATJ
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Alias de gène	channel-interacting PDZ domain protein, FLJ26982, hINADL, inactivation no after-potential D-like protein, Inadl protein, InaD-like, InaD-like (Drosophila), inaD-like protein, Pals1-associated tight junction protein, PATJCipp, PDZ domain protein, Protein associated to tight junctions
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunocytochemistry, Immunofluorescence
Conjugué	Unconjugated
Formule	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Symboles de gène(s)	INADL
Immunogène	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
Quantité	100 μL
Disciplines de recherche	Signal Transduction
Identification génétique (Entrez)	10207
Espèces cibles	Human
Isotype	IgG

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

For Research Use Only

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

PATJ Antibody, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions