missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 18293287

PEPD Antibody, Novus Biologicals™

Code produit 18293287 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18293287 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18293287 Fournisseur Novus Biologicals Code fournisseur NBP186072

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

PEPD Polyclonal specifically detects PEPD in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène PEPD
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène aminoacyl-L-proline hydrolase, EC 3.4.13.9, Imidodipeptidase, MGC10905, peptidase Dimidodipeptidase, PRD, PROLIDASE, Proline dipeptidase, xaa-Pro dipeptidase, X-Pro dipeptidase
Symboles de gène(s) PEPD
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:ITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDE
Méthode de purification Affinity Purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 5184
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.