missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phospholamban Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-94385-0.02ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Phospholamban Polyclonal antibody specifically detects Phospholamban in Mouse, Rat samples. It is validated for Western Blot
Spécification
| Phospholamban | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| CMD1PPLBcardiac phospholamban, phospholamban | |
| A synthetic peptide corresponding to a sequence within amino acids 1-52 of human Phospholamban (NP_002658.1). MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL | |
| 0.02 mL | |
| Signal Transduction | |
| 5350 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu