missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIGP Antibody (2E7), Novus Biologicals™
Mouse Monoclonal Antibody
Marque: Novus Biologicals H00051227-M01
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
PIGP Monoclonal antibody specifically detects PIGP in Human samples. It is validated for Western Blot, ELISA, ELISA
Spécification
| PIGP | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| class P, DCRCDown syndrome critical region protein C, Down syndrome critical region protein 5, DSCR5DCRC-S, DSCRC, DSRC, EC 2.4.1.198, phosphatidylinositol glycan anchor biosynthesis, class P, Phosphatidylinositol-glycan biosynthesis class P protein, phosphatidylinositol-n-acetylglucosaminyltranferase subunit, PIG-P | |
| PIGP (NP_710149, 77 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 2E7 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| NP_710149 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 51227 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu