missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. POP7 Antibody, Novus Biologicals™

POP7 Antibody, Novus Biologicals™

Code produit 18423961 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
25 μL
Conditionnement:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18423961 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18423961 Fournisseur Novus Biologicals Code fournisseur NBP19228225ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

POP7 Polyclonal specifically detects POP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène POP7
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène 0610037N12Rik, EC 3.1.26.5, hPOP7, processing of precursor 7, ribonuclease P subunit, processing of precursor 7, ribonuclease P subunit (S. cerevisiae), processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p20, Ribonucleases P/MRP protein subunit POP7 homolog, RNaseP protein p20, RPP20S. cerevisiae) homolog
Symboles de gène(s) POP7
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Core ESC Like Genes, Stem Cell Markers
Primaire ou secondaire Primary
Identification génétique (Entrez) 10248
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.