missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PPEF1 Polyclonal specifically detects PPEF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
Spécification
| Antigène | PPEF1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | EC 3.1.3.16, PP7, PPEF, PPEF-1, PPP7C, PPP7CA, protein phosphatase 7, catalytic subunit, alpha isozyme, Protein phosphatase with EF calcium-binding domain, protein phosphatase, EF-hand calcium binding domain 1, protein phosphatase, serine/threonine type, with EF-hands, serine/threonine protein phosphatase 7, Serine/threonine-protein phosphatase 7, serine/threonine-protein phosphatase with EF-hands 1 |
| Symboles de gène(s) | PPEF1 |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP |
| Afficher plus |
For Research Use Only
Nom du produit
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?