missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. PPEF1 Antibody, Novus Biologicals™

PPEF1 Antibody, Novus Biologicals™

Code produit 18470881 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18470881 25 μL 25µL
18288906 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18470881 Fournisseur Novus Biologicals Code fournisseur NBP18723925ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

PPEF1 Polyclonal specifically detects PPEF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène PPEF1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène EC 3.1.3.16, PP7, PPEF, PPEF-1, PPP7C, PPP7CA, protein phosphatase 7, catalytic subunit, alpha isozyme, Protein phosphatase with EF calcium-binding domain, protein phosphatase, EF-hand calcium binding domain 1, protein phosphatase, serine/threonine type, with EF-hands, serine/threonine protein phosphatase 7, Serine/threonine-protein phosphatase 7, serine/threonine-protein phosphatase with EF-hands 1
Symboles de gène(s) PPEF1
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Protein Phosphatase
Primaire ou secondaire Primary
Identification génétique (Entrez) 5475
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.