missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PPP2R5B Polyclonal specifically detects PPP2R5B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
Spécification
| Antigène | PPP2R5B |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | B56B, FLJ35411, PP2A B subunit isoform B56-beta, PP2A B subunit isoform B'-beta, PP2A B subunit isoform PR61-beta, PP2A B subunit isoform R5-beta, PR61B, protein phosphatase 2, regulatory subunit B (B56), beta isoform, protein phosphatase 2, regulatory subunit B', beta, protein phosphatase 2, regulatory subunit B', beta isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform |
| Symboles de gène(s) | PPP2R5B |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP |
| Afficher plus |
For Research Use Only
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?