missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 20S beta 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-33380-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Proteasome 20S beta 3 Polyclonal specifically detects Proteasome 20S beta 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| Proteasome 20S beta 3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P49720 | |
| PSMB3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.4.25.1, HC10-II, MGC4147, proteasome (prosome, macropain) subunit, beta type, 3, Proteasome chain 13, Proteasome component C10-II, proteasome subunit beta type-3, Proteasome theta chain | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5691 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu