missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PRPF6 Polyclonal antibody specifically detects PRPF6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | PRPF6 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formule | PBS (pH 7.2) and 40% Glycerol |
| Alias de gène | androgen receptor N-terminal domain transactivating protein-1, ANT-1, bB152O15.1, C20orf14, chromosome 20 open reading frame 14, hPrp6, p102 U5 small nuclear ribonucleoprotein particle-binding protein, pre-mRNA-processing factor 6, Prp6, PRP6 homolog, PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), PRP6 pre-mRNA processing factor 6 homolog (yeast), putative mitochondrial outer membrane protein import receptor, TOM, U5 snRNP-associated 102 kDa protein, U5-102 kDa protein, U5-102K |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids: ARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNL |
| Méthode de purification | Immunogen affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?