missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 18358649

PSMD6 Antibody, Novus Biologicals™

Code produit 18358649 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mg
Conditionnement:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18358649 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18358649 Fournisseur Novus Biologicals Code fournisseur H00009861D01P

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

PSMD6 Polyclonal antibody specifically detects PSMD6 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène PSMD6
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Formule PBS (pH 7.4)
Numéro d’ordre du gène NP_055629.1
Alias de gène 26S proteasome non-ATPase regulatory subunit 6, Breast cancer-associated protein SGA-113M, KIAA010726S proteasome regulatory subunit S10, p42A, p44S10, PFAAP4, Phosphonoformate immuno-associated protein 4, proteasome (prosome, macropain) 26S subunit, non-ATPase, 6,26S proteasome regulatory subunit RPN7, Proteasome regulatory particle subunit p44S10, Rpn7, S10, SGA-113M
Espèces hôtes Rabbit
Immunogène PSMD6 (NP_055629.1, 1 a.a. - 389 a.a.) full-length human protein. MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Méthode de purification Protein G purified
Quantité 0.1 mg
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 9861
Espèces cibles Human
Contenu et stockage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.