missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody, Novus Biologicals™

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody, Novus Biologicals™

Code produit 18432401 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18432401 25 μL 25µL
18252778 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18432401 Fournisseur Novus Biologicals Code fournisseur NBP18730925ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Polyclonal specifically detects Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, EC 3.1.3, EC 3.1.3.43, MGC119646, PDH, PDP 1, PDPC, PDPC 1, PDPFLJ32517, PPM2CFLJ56179, Protein phosphatase 2C, protein phosphatase 2C, magnesium-dependent, catalytic subunit, pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase, Pyruvate dehydrogenase phosphatase catalytic subunit 1, pyruvate dehyrogenase phosphatase catalytic subunit 1
Symboles de gène(s) PDP1
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 54704
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.