missing translation for 'onlineSavingsMsg'
Learn More

RanBP3 Antibody, Novus Biologicals™

Code produit 30229077 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
20 μL
100 μL
Conditionnement:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30229077 20 μL 20µL
30227107 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30229077 Fournisseur Novus Biologicals Code fournisseur NBP33318320ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Monoclonal Antibody

RanBP3 Monoclonal antibody specifically detects RanBP3 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène RanBP3
Applications ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugué Unconjugated
Dilution ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formule PBS (pH 7.3), 50% glycerol, 0.05% BSA
Alias de gène DKFZp586I1520, RAN binding protein 3, ran-binding protein 3, RAN-binding protein-3, RanBP3
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RanBP3 (Q9H6Z4).,, Sequence:, MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAGASASTPPPPAPEAQLPPFPRELAGRSAGGS
Méthode de purification Affinity purified
Quantité 20 μL
État réglementaire RUO
Disciplines de recherche Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 8498
Espèces cibles Mouse, Rat
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.