missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RanBP3 Monoclonal antibody specifically detects RanBP3 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | RanBP3 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugué | Unconjugated |
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formule | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Alias de gène | DKFZp586I1520, RAN binding protein 3, ran-binding protein 3, RAN-binding protein-3, RanBP3 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RanBP3 (Q9H6Z4).,, Sequence:, MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAGASASTPPPPAPEAQLPPFPRELAGRSAGGS |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?