missing translation for 'onlineSavingsMsg'
Learn More

Ras-GAP Antibody, Novus Biologicals™

Code produit 30226838 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
20 μL
100 μL
Conditionnement:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30226838 100 μL 100µL
30227030 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30226838 Fournisseur Novus Biologicals Code fournisseur NBP333535100ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Monoclonal Antibody

Ras-GAP Monoclonal antibody specifically detects Ras-GAP in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène Ras-GAP
Applications ELISA, Western Blot
Classification Monoclonal
Conjugué Unconjugated
Dilution Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL
Formule PBS (pH 7.3), 50% glycerol, 0.05% BSA
Alias de gène CMAVM;CM-AVM;CMAVM1;GAP;p120;p120GAP;p120RASGAP;PKWS;Ras GTPase-activating protein 1;RASA;RASA1;RASGAP
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Ras-GAP (P20936).,, Sequence:, KSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Disciplines de recherche Cancer, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Phospho Specific, Signal Transduction, Stem Cell Markers
Primaire ou secondaire Primary
Identification génétique (Entrez) 5921
Espèces cibles Human, Mouse
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.