missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Ras-GAP Monoclonal antibody specifically detects Ras-GAP in Human,Mouse samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antigène | Ras-GAP |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL |
| Formule | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Alias de gène | CMAVM;CM-AVM;CMAVM1;GAP;p120;p120GAP;p120RASGAP;PKWS;Ras GTPase-activating protein 1;RASA;RASA1;RASGAP |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Ras-GAP (P20936).,, Sequence:, KSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?