missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12178-B-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15949608

  • 2000.00€ / 1mg
Expédition estimée: 17-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

Hepatitis C HCV NS4 a+b Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis C
Biotin
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions