missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HSV HSV-2 gB Protein

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12342-500ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15950119

  • 800.00€ / 500µg
Expédition estimée: 09-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

HSV HSV-2 gB Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HSV
His
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Protein is >90% pure as determined by SDS PAGE.
Research Use Only
Recombinant Protein
E. coli
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions