missing translation for 'onlineSavingsMsg'
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) Code produit.: 18735843
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Code produit. p-7120949 Tous les produits Bio Techne Produits
100 μg, 1 kit
Code nomenclature Nacres: NA.28
missing translation for 'orderingAttributeHoverText'
Quantité:
100 μg
200 μg
500 μg
Förpackningsstorlek
1 kit
200µg
500µg
Denne vare kan ikke returneres. Se returpolitik

Code produit. 18735843

Marque: Novus Biologicals™ NBP254789100UG

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
TRUSTED_SUSTAINABILITY

Tekniske data

À utiliser avec (application) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formule PBS
Identification génétique (Entrez) 6622
Nom Human alpha-Synuclein Aggregate Protein
Méthode de purification >95% pure by SDS-PAGE
Quantité 100 μg
Source E.Coli
Immunogène MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Conditions de stockage Store at −80°C. Avoid freeze-thaw cycles.
État réglementaire RUO
Alias de gène alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Symbole de gène(s) SNCA
Activité biologique Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Type de produit Recombinant Protein
Conjugué Unconjugated
Réactivité croisée Human
Recombinant Recombinant
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) >

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.