missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human LR3 IGF1 Protein

A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10775-500ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15955128

  • 157.00€ / 500µg
Expédition estimée: 09-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

LR3 IGF1 Protein
500 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Greater than 95.0% as determined by SDS-PAGE and HPLC.
Research Use Only
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Human
Untagged
Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS.
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions