missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse IL17E Protein

A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10725-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15944978

  • 3595.00€ / 1mg
Expédition estimée: 13-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

140806
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Il25
Recombinant Protein
E. coli
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
IL17E Protein
1 mg
< 1.0 EU per ug protein as determined by the LAL method.
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Mouse
Untagged
IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions