Learn More
enQuireBio™ Recombinant Mouse IL17E Protein
A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP10725-25ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
140806 | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
Research Use Only | |
Il25 | |
Recombinant Protein | |
E. coli | |
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA |
IL17E Protein | |
25 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. | |
Mouse | |
Untagged | |
IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |