missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse Noggin Protein

A cDNA sequence encoding the Noggin was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10795-20ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15905198

  • 205.00€ / 20µg
Expédition estimée: 23-09-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

Noggin Protein
20 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 M 105 IU/mg in the presence of 5ng/ml BMP-4.
Mouse
Untagged
Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Vidéos
FDS
Documents
Certificats
Promotions

Promotions