missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse Noggin Protein

A cDNA sequence encoding the Noggin was constructed and used to recombinantly synthesize the protein.

137.00€ - 5285.00€

Spécification

Nom Noggin Protein
Type de produit Recombinant Protein
Marqueur de protéine Untagged
Espèces hôtes E. coli
Réactivité croisée Mouse
Consulter d'autres spécifications

Produits 3
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
15915198
Afficher les documents Détails de la promotion
enQuireBio™
QP10795-5UG
5 μg
137.00€
5µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 05-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
15905198
Afficher les documents Détails de la promotion
enQuireBio™
QP10795-20UG
20 μg
205.00€
20µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 05-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
15995188
Afficher les documents Détails de la promotion
enQuireBio™
QP10795-1MG
1 mg
5285.00€
1mg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 05-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

Spécification

Spécification

Noggin Protein
Untagged
Mouse
Greater than 95.0% as determined by SDS-PAGE.
Recombinant Protein
E. coli
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
FDS
Product Certifications