missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse Noggin Protein
A cDNA sequence encoding the Noggin was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP10795-20ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
Noggin Protein | |
Research Use Only | |
The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 M 105 IU/mg in the presence of 5ng/ml BMP-4. | |
Mouse | |
Untagged | |
Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA. |
20 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC | |
Greater than 95.0% as determined by SDS-PAGE. |