Learn More
enQuireBio™ Recombinant other Pramlintide Protein
A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13132-1mg
Informations supplémentaires : Poids : 0.01000kg
Spécification
Pramlintide Protein | |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Other | |
Untagged | |
The protein was lyophilized with no additives. |
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 |