missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Pramlintide Protein

A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13132-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15952599

  • 120.00€ / 1mg
Expédition estimée: 08-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

Pramlintide Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
The protein was lyophilized with no additives.
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions