missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit GHBP Protein

A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10642-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15944498

  • 4480.00€ / 1mg
Expédition estimée: 08-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

GHBP Protein
1 mg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Greater than 98.0% as determined bySDS-PAGE.
Research Use Only
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Rabbit
Untagged
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions