missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat CNTF Protein

A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10559-25ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15924248

  • 205.00€ / 25µg
Expédition estimée: 27-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

CNTF Protein
25 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Research Use Only
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Rat
Untagged
Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Vidéos
FDS
Documents
Certificats
Promotions

Promotions