missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat RAP Protein

A cDNA sequence encoding the RAP was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13264-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15943019

  • 3730.00€ / 1mg
Expédition estimée: 13-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

RAP Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The protein (1 mg/ml) was lyophilized after from a sterile solution containing TBS pH 7.5, 0.1% BSA and 0.09% NaN3.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions