missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat RAP Protein

A cDNA sequence encoding the RAP was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13264-20ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15953019

  • 181.00€ / 20µg
Expédition estimée: 09-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

RAP Protein
20 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The protein (1 mg/ml) was lyophilized after from a sterile solution containing TBS pH 7.5, 0.1% BSA and 0.09% NaN3.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions