missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant SARS SARS MERS Protein

A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.

232.00€ - 1810.00€

Spécification

Nom SARS SARS MERS Protein
Type de produit Recombinant Protein
Marqueur de protéine His
Espèces hôtes E. coli
Réactivité croisée SARS
Consulter d'autres spécifications

Produits 3
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
15913509
Afficher les documents Détails de la promotion
enQuireBio™
QP13419-100UG
100 μg
232.00€
100µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 02-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
15933509
Afficher les documents Détails de la promotion
enQuireBio™
QP13419-500UG
500 μg
905.00€
500µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 02-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
15923509
Afficher les documents Détails de la promotion
enQuireBio™
QP13419-1MG
1 mg
1810.00€
1mg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 02-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

Spécification

Spécification

SARS SARS MERS Protein
His
SARS
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Recombinant Protein
E. coli
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
FDS
Product Certifications