missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RIC1 Polyclonal antibody specifically detects RIC1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigène | RIC1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formule | PBS (pH 7.2), 40% Glycerol |
| Alias de gène | BA207C16.1, CIP150, Connexin 43-Interacting Protein 150 KDa, Connexin-43-Interacting Protein Of 150 KDa, Protein RIC1 Homolog, RAB6A GEF Complex Partner 1, RIC1, RIC1 Homolog, RAB6A GEF Complex Partner 1 |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a recombinant protein corresponding to amino acids: YCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPD |
| Méthode de purification | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?