missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RIP140 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Spécification
| Antigène | RIP140 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Product Code | Brand | Quantité | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantité | Price | Quantity & Availability | |||||
|
18226302
|
Novus Biologicals
NBP2-57193 |
100 μL |
624.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18631558
|
Novus Biologicals
NBP2-57193-25ul |
25 μL |
415.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
RIP140 Polyclonal specifically detects RIP140 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RIP140 | |
| Polyclonal | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8204 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPIL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 10RIP140Receptor-interacting protein 140, FLJ77253, nuclear receptor interacting protein 1, nuclear receptor-interacting protein 1, receptor interacting protein 140 | |
| NRIP1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title