missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. RNF20 Antibody, Novus Biologicals™

RNF20 Antibody, Novus Biologicals™

Code produit 18256224 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
25 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18256224 100 μL 100µL
18679408 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18256224 Fournisseur Novus Biologicals Code fournisseur NBP254995

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

RNF20 Polyclonal specifically detects RNF20 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spécification

Antigène RNF20
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formule PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gène BRE1, BRE1 E3 ubiquitin ligase homolog, BRE1-A, BRE1AMGC129667, E3 ubiquitin-protein ligase BRE1A, EC 6.3.2, EC 6.3.2.-, FLJ11189, FLJ20382, hBRE1MGC129668, homolog of S. cerevisiae BRE1, KAIA2779, ring finger protein 20KIAA2779
Symboles de gène(s) RNF20
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLAS
Méthode de purification Affinity Purified
Quantité 100 μL
État réglementaire RUO
Disciplines de recherche Chromatin Research, Zinc Finger
Primaire ou secondaire Primary
Identification génétique (Entrez) 56254
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.