missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. RSK3 Antibody, Novus Biologicals™

RSK3 Antibody, Novus Biologicals™

Code produit 18625946 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18625946 25 μL 25µL
18606065 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18625946 Fournisseur Novus Biologicals Code fournisseur NBP24882525ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

RSK3 Polyclonal antibody specifically detects RSK3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigène RSK3
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Formule PBS (pH 7.2), 40% Glycerol
Alias de gène EC 2.7.11, EC 2.7.11.1, HU-2, MAP kinase-activated protein kinase 1c, MAPK-activated protein kinase 1c, MAPKAP kinase 1c, MAPKAPK-1c, MAPKAPK1C, p90-RSK 2, p90RSK2, p90-RSK3, ribosomal protein S6 kinase alpha 2, ribosomal protein S6 kinase alpha-2, ribosomal protein S6 kinase, 90kD, polypeptide 2, ribosomal protein S6 kinase, 90kDa, polypeptide 2, Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2, RSK, RSK-3, RSK3pp90RSK3, S6K-alpha, S6K-alpha2, S6K-alpha-2
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGF
Méthode de purification Immunogen affinity purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Protein Kinase
Primaire ou secondaire Primary
Identification génétique (Entrez) 6196
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.