missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RTP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP3-09462-100UL
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
RTP1 Polyclonal specifically detects RTP1 in Human samples. It is validated for Western Blot.
Spécification
| RTP1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| MGC35450, receptor (chemosensory) transporter protein 1, receptor transporter protein 1, receptor transporting protein 1, receptor-transporting protein 1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human RTP1 (NP_714919). Peptide sequence SEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLII | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 132112 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu