missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 18202052

SDF4 Antibody, Novus Biologicals™

Code produit 18202052 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18202052 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18202052 Fournisseur Novus Biologicals Code fournisseur NBP169311

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

SDF4 Polyclonal specifically detects SDF4 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène SDF4
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène B1AME6
Alias de gène 45 kDa calcium-binding protein, CAB45, Cab45Stromal cell-derived factor 4, calcium binding protein, SDF-4, stromal cell derived factor 4
Symboles de gène(s) SDF4
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to SDF4(stromal cell derived factor 4) The peptide sequence was selected from the C terminal of SDF4. Peptide sequence KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA.
Poids moléculaire de l’antigène 39 kDa
Méthode de purification Protein A purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 51150
Spécificité du test Zebrafish: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Zebrafish
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.