missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Seryl tRNA synthetase Polyclonal specifically detects Seryl tRNA synthetase in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Spécification
Spécification
| Antigène | Seryl tRNA synthetase |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formule | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gène | EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase |
| Symboles de gène(s) | SARS |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQ |
| Afficher plus |
For Research Use Only
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
¿Detecta una oportunidad de mejora?