missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SFN (Human) Recombinant Protein
Human SFN partial ORF ( AAH00329.1, 3 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
Marque: Abnova™ H00002810-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
- Sequence: RASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEE
Spécification
| AAH00329.1 | |
| stratifin | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SFN | |
| GST |
| 2810 | |
| Wheat germ expression system | |
| 10 μg | |
| YWHAS | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |