Abnova™ SFN (Human) Recombinant Protein

Name: Abnova&trade; SFN (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16105641
Price: 335.00 EUR

Human SFN partial ORF ( AAH00329.1, 3 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Marque: Abnova™ H00002810-Q01.10ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16105641

Expédition estimée: 09-05-2023
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

Sequence: RASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEE

Spécification

Numéro d’adhésion	AAH00329.1
Nom	stratifin
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	SFN
Marqueur de protéine	GST

Identification génétique (Entrez)	2810
Méthode de préparation	Wheat germ expression system
Quantité	10 μg
Alias de gène	YWHAS
Espèces hôtes	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description