missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SGLT1/SLC5A1 Antibody [Allophycocyanin], Novus Biologicals Biologicals™
Tous les produits Bio Techne ProduitsDescription
SGLT1/SLC5A1 Polyclonal antibody specifically detects SGLT1/SLC5A1 in Human samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antigène | SGLT1/SLC5A1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugué | APC |
| Formule | PBS |
| Alias de gène | D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SGLT1/SLC5A1 (NP_000334.1).,, Sequence:, ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?