missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SNRPE Polyclonal antibody specifically detects SNRPE in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | SNRPE |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formule | PBS (pH 7.3), 50% glycerol |
| Alias de gène | B-raf, Sm protein E, small nuclear ribonucleoprotein E, small nuclear ribonucleoprotein polypeptide E, SmE, Sm-ESME, snRNP-E |
| Espèces hôtes | Rabbit |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1). MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?