missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. SNRPF Antibody - Azide and BSA Free, R&D Systems™

SNRPF Antibody - Azide and BSA Free, R&D Systems™

Code produit 18606540 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.02 mL
0.1 mL
Conditionnement:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18606540 0.1 mL 0.10mL
18658391 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18606540 Fournisseur Novus Biologicals Code fournisseur NBP2938540.1ml
 Article restreint
Expédition estimée: 03-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SNRPF Polyclonal specifically detects SNRPF in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène SNRPF
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formule PBS (pH 7.3), 50% glycerol
Alias de gène PBSCF, Sm protein F, small nuclear ribonucleoprotein polypeptide F, SMF, Sm-Fsmall nuclear ribonucleoprotein F, snRNP-F
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1). MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 6636
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.