missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. SPT3 Antibody - Azide and BSA Free, Novus Biologicals™

SPT3 Antibody - Azide and BSA Free, Novus Biologicals™

Code produit 18676701 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.02 mL
0.1 mL
Conditionnement:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18676701 0.02 mL 0.02mL
18633590 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18676701 Fournisseur Novus Biologicals Code fournisseur NBP2944770.02ml

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
 Voir les produits de remplacement

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

SPT3 Polyclonal antibody specifically detects SPT3 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigène SPT3
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500-1:2000
Formule PBS (pH 7.3), 50% glycerol
Alias de gène SPT3-like protein, SPT3SPT3L, suppressor of Ty (S.cerevisiae) 3 homolog, suppressor of Ty 3 homolog (S. cerevisiae), transcription initiation protein SPT3 homolog
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SPT3 (NP_852001.1). DARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDL
Méthode de purification Affinity purified
Quantité 0.02 mL
État réglementaire RUO
Disciplines de recherche Cell Cycle and Replication
Primaire ou secondaire Primary
Identification génétique (Entrez) 8464
Espèces cibles Human, Mouse
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.