missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SSTK-IP Polyclonal antibody specifically detects SSTK-IP in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Spécification
Spécification
| Antigène | SSTK-IP |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Formule | PBS (pH 7.2) and 40% Glycerol |
| Numéro d’ordre du gène | Q96A04 |
| Alias de gène | C1orf182, chromosome 1 open reading frame 182, MGC26877, RP11-443G18.5, SIP, SSTK-interacting protein (SSTK-IP), SSTK-IP |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a recombinant protein corresponding to amino acids: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?