missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST3GAL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Spécification
| Antigène | ST3GAL5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18206412
|
Novus Biologicals
NBP2-56522 |
100 μL |
624.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18698618
|
Novus Biologicals
NBP2-56522-25ul |
25 μL |
415.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
ST3GAL5 Polyclonal specifically detects ST3GAL5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
| ST3GAL5 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8869 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| alpha 2,3-sialyltransferase V, CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, EC 2.4.99.9, Ganglioside GM3 synthase, GM3 synthase, lactosylceramide alpha-2,3-sialyltransferase, Sialyltransferase 9, sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;GM3 synthase), SIATGM3S, ST3 beta-galactoside alpha-2,3-sialyltransferase 5, ST3Gal V, ST3GALV, ST3GalVSIAT9SATI | |
| ST3GAL5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit