missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syndecan-2/CD362 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 559.00€
Spécification
| Antigène | Syndecan-2/CD362 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18281242
|
Novus Biologicals
NBP2-58489 |
100 μL |
559.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18685637
|
Novus Biologicals
NBP2-58489-25ul |
25 μL |
369.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
Syndecan-2/CD362 Polyclonal specifically detects Syndecan-2/CD362 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
| Syndecan-2/CD362 | |
| Polyclonal | |
| Rabbit | |
| Extracellular Matrix | |
| CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2 | |
| SDC2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6383 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit