missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP3-10510-100UL
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TEF1 Polyclonal specifically detects TEF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| TEF1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| NTEF-1, protein GT-IIC, TEA domain family member 1 (SV40 transcriptional enhancer factor), TEAD-1 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human TEF1 (NP_068780). Peptide sequence YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7003 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu