missing translation for 'onlineSavingsMsg'
Learn More

Topoisomerase I Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™

Code produit 30496698 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30496698 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30496698 Fournisseur Novus Biologicals Code fournisseur NBP335246JF669

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

Topoisomerase I Polyclonal antibody specifically detects Topoisomerase I in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène Topoisomerase I
Applications ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Janelia Fluor 669
Formule 50mM Sodium Borate
Alias de gène DNA topoisomerase 1, DNA topoisomerase I, EC 5.99.1.2, TOPI, topoisomerase (DNA) I, type I DNA topoisomerase
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Topoisomerase I (Topoisomerase I (TOP1)) (NP_003277.1).,, Sequence:, MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing
Primaire ou secondaire Primary
Identification génétique (Entrez) 7150
Espèces cibles Human, Mouse
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.