missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. TSPAN32/TSSC6 Antibody, Novus Biologicals™

TSPAN32/TSSC6 Antibody, Novus Biologicals™

Code produit 18282453 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18282453 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18282453 Fournisseur Novus Biologicals Code fournisseur NBP162646

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

TSPAN32/TSSC6 Polyclonal specifically detects TSPAN32/TSSC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène TSPAN32/TSSC6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène Q96QS1-2
Alias de gène ART1, FLJ17158, FLJ97586, MGC22455, pan-hematopoietic expression, PHEMXPHMX, Protein Phemx, tetraspanin 32, tetraspanin-32, tspan-32, TSSC6pan-hematopoietic expression protein, tumor-suppressing STF cDNA 6, tumor-suppressing subchromosomal transferable fragment cDNA 6, tumor-suppressing subtransferable candidate 6
Symboles de gène(s) TSPAN32
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to TSPAN32(tetraspanin 32) The peptide sequence was selected from the middle region of TSPAN32. Peptide sequence YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR.
Poids moléculaire de l’antigène 31 kDa
Méthode de purification Protein A purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 10077
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.