missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. TWA1 Antibody, Novus Biologicals™

TWA1 Antibody, Novus Biologicals™

Code produit p-200043795 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25ul
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18492952 25ul 25µL
18189181 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18492952 Fournisseur Novus Biologicals Code fournisseur NBP21439725ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

TWA1 Polyclonal specifically detects TWA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène TWA1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène bA305P22.1, C20orf11, chromosome 20 open reading frame 11, FLJ20602, GID complex subunit 8 homolog (S. cerevisiae), Twa1, TWA1protein C20orf11, two hybrid associated protein 1, Two hybrid-associated protein 1 with RanBPM
Symboles de gène(s) GID8
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to the amino acids: GQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALLAF
Méthode de purification Affinity Purified
Quantité 25ul
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 54994
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.