missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. U11/U12-35K Antibody, Novus Biologicals™

U11/U12-35K Antibody, Novus Biologicals™

Code produit 18610309 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
25 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18610309 25 μL 25µL
18269734 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18610309 Fournisseur Novus Biologicals Code fournisseur NBP25620325ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

U11/U12-35K Polyclonal specifically detects U11/U12-35K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spécification

Antigène U11/U12-35K
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formule PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gène HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog
Symboles de gène(s) SNRNP35
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 11066
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.